Outlook formatting options greyed out.
May 10, 2023 · Outlook Version 1.
Outlook formatting options greyed out ) be unavailable? Obviously when text is right clicked, the corresponding including those options is also grayed out. Email is set to default to RTF and cannot be changed to HTLM or Plain Text. 504. The bottom toolbar having text formatting and file attachment Microsoft Office Technician: TechAshu If the email is set to Plain Text, formatting options like bold, italics, colors, and font styles will be unavailable. Recent builds of new Outlook include a privacy option similar to the one in Office, where you can enable external Nov 2, 2020 · The Insert > Hyperlink option used to work fine before, but now it is grayed out. Formatting Outlook Text If you work with any other Microsoft Office applications, you will recognize Sep 21, 2016 · Why would the Basic Text section of the Ribbon be grayed out so that text changes (such as Bold, Italic, Color etc. The options are greyed out. If you cannot change or add a new email signature, this is most likely caused by a certain value entered into Registry. Oct 13, 2022 · All format options are grayed out. 300 Client Version is 20230505004. Sep 11, 2024 · If you find an email with the formatting tools greyed out, change the message to HTML format. msg format and attached that template on Outlook to forward to people within my organization as an attachment But after attaching the template there is a Send option which is greyed out. Has anyone run into this personally? Rick May 7, 2022 · Just getting started with this version of Outlook on a new PC as part of Office Home and Business. 30 - Outlook for Mac). Will not allow to change. ). This persists despite “view” settings, despite Theme settings, regardless of Light … Aug 10, 2019 · Problems may arise if you adjust your email software to send messages in the received format. Click on the “Format Text” tab. Under Compose Messages, change the Rich Text/Plain Text to HTML Click on the OK button This will set the format to HTML which lets you see the image signature in your Outlook. Also, if this is happening on all e-mails you may want to change your formatting under OPTIONS From the main Outlook window - TOOLS > OPTIONS > MAIL FORMAT then under message format chose the Compose in this message format and click anything but "plain tezt" May 12, 2021 · I have seen this topic come up before, but the only fix I found is to change the email format from basic to HTML in the options menu. For some reason I cannot format new emails. The spreadsheet isn't protected, and I don't think its shared with anyone. Jan 16, 2020 · Hello, I am having a problem with my Outlook having greyed out certain features when I am not emailing someone in my company. Oct 22, 2023 · Change the Message Format: Steps: In Outlook, click on the ‘File’ tab > Click ‘Options. all of the functions under the basic text on the ribbon are grayed out / disabled. When you create your reply, go to Format Text to find your formatting options: The new email will start out as Plain Text, as that’s what the original email was sent as. Outlook. Why has this happened? Aug 5, 2024 · After reading, I understand that the text formatting options is greyed out in Outlook for Mac. Click on HTML to highlight. The new Outlook for Windows brings the latest features, intelligent assisted capabilities and a new modern and Features like picture formatting—edges, shadows, reflections, and layout adjustments—are integral to creating polished and professional visuals. Now on my inbox, the editor tool seems to have disappeared, meaning my emails cannot be proof read / spell checked anymore. Note that these steps will help you access the missing bottom toolbar from the email composer in the newest version of the Outlook app. Hello, I hope you're doing well. Outlook contains a number of options that you can control to affect the content of email messages you send and receive. How do I fix this? It sounds like you are using a default theme for your email. Please help thanks! Mar 21, 2023 · All of a sudden all of my text format options (font type, size etc. Feb 26, 2005 · Yes, If you have the formatting set to plain text, that would cause it to be grayed out. Aug 2, 2022 · For the MS Outlook application, Go to Outlook and tap on File Select options and click on Mail. Look for the ‘Compose messages’ section. Mar 14, 2023 · Many (most) of my icons on ribbon bar are suddenly grayed out. When a theme is assigned, you have three choices for the font: Use theme's font, Use my font when replying and forwarding messages, and Always use my font. I hope this helps. I have three questions: Why would someone spend the calories it took to change the program so that I can't format responses to plain text emails? Has that person been tortured yet? How do I change this setting? Thank you. 2023. , you need to check these settings. If this section is grayed out, you are currently composing in Plain Text format. Feb 11, 2024 · Client texted me "When I now attempt to send an email, the paste clipboard and basic text sections are all grayed out. Nov 29, 2023 · All of a sudden, the options shown are greyed out. Sep 8, 2023 · This tutorial will show you how to change the default message format settings when composing messages in the Outlook for Windows app for your account in Windows 10 and Windows 11. 20202. I know my version supports polls because other people can send them Jun 23, 2009 · The 400 people where I work cannot set Outlook 2003 Mail Format options. The "insert photo" option is greyed out so I cannot put a photo into an email, which I need to do for work. 0. When you open a new email item, you can only use the RTF or change your message to Plain Text, however HTML format is Feb 17, 2025 · Hi, I believe recently there was an update in new Outlook and now when I select an email, in the right hand panel I have the options to Reply, Reply all and Forward, but they are grayed out. Are you having trouble with formatting options in Outlook? In this video, we will guide you through the reasons why formatting tools might be greyed out and how to resolve this frustrating issue. Apr 14, 2016 · When adding an AutoCorrect entry, I noticed that there is an option for "Plain text" and "Formatted text". Rich Text or HTML is selected as message format type. I go up the heading and have to change it to 28 so I can see the letters. Some email tools automatically set the replying message format to match the format of the email that you’ve received. I have set the "Compose new emails" setting as HTML (or rather that's what it was set at when I checked) but the formatting options remain stubbornly greyed out. Jun 26, 2024 · As I known, not all conditional formatting options in classic Outlook are available in new Outlook. I know my version supports polls because other people can send them Sep 30, 2016 · After living with this annoyance for a while, I finally figured out how to change my reply to use HTML format (which gives me back my formatting options). Outlook is showing all HTML emails with a pink background/padding and odd font (typeface). Jun 25, 2025 · If your Paste Special option is missing, look here. Nov 11, 2022 · I am running Outlook 365 version 2210 build 15726. Aug 7, 2007 · Outlook 2007. I would appreciate it if you When using Outlook 2019 on my Desktop PC I can use the translate feature without issues. This article provides possible solutions to help resolve formatting issues with bullet points in emails. Outlook Ver. :2304 Build 16. Mar 12, 2024 · Hello! It seems to have just started recently, but the refine options in Outlook are greyed out on a couple of different computers and even the indexing options are greyed out, I have looked at quite a few forums to try and figure out what might be… Aug 28, 2018 · The text formatting features and many others are greyed out on my MS Outlook version (15. However, in “plain text” format, the formatting options are grayed out, you cannot set links and you cannot bold the written text or change its size. Jul 9, 2025 · Why Are My Formatting Options Greyed Out in Outlook Emails? for Harrogate & Yorkshire Have you ever opened Outlook, started typing an email, and suddenly realised that all your formatting options are greyed out in Outlook emails? No bold, no italics, no colours — just plain text with no way to change it. Sep 26, 2024 · Outlook will not allow me to format text, even after switching to HTML options are still greyed out - please help Outlook Setting has plaintext Greyed out! So this is where the setting is located but a user on my network has their outlook setting messaging format locked (greyed out) on plaintext. Jul 2, 2024 · I notice today that all my menu bar options are greyed out, and therefore unusable. To understand the situation and be able to offer you relevant suggestions, we would need a little more information from you. which makes it hard to distinguish the reply from the original message. but the same attachment when I copy in drive/draft so that send option is highlighted. May 10, 2023 · Outlook Version 1. In the above dialog (Outlook 2010) the text type is a fixed "Plain text" and grayed out, so I can't select the "Formatted text" I need to insert a smiley bitmap. Your signature looks different than usual, you can’t format text, or change fonts… even doing something simple, like making a word bold or italic, is impossible as a good portion of the ribbon is greyed out and unselectable. Dec 9, 2024 · If the mail composer toolbar of Outlook is available on the top, but all the formatting options are greyed out, switching to HTML instead of plain text will enable all the elements of the toolbar. You can change this setting in Outlook under File > Options > Mail and then select your preferred format. Jan 15, 2025 · HI,I have no realtime spell check in Outlook for Windows client 2021. May 14, 2024 · New Outlook users are reporting that the Editor button is grayed out and the spellcheck is not working in new Outlook. Nov 13, 2025 · If the editor in Outlook is greyed out and spell check is not working, it could be due to a few reasons. Any Help? Nov 13, 2025 · If the editor in Outlook is greyed out and spell check is not working, it could be due to a few reasons. In Outlook, open a new email message or the message with the issue. Aug 1, 2021 · I can't right click anywhere on the sheets containing the charts, and all the options on the 'Chart Design' and 'Format' ribbon tabs are greyed out. Jan 29, 2025 · Hi Spicy Neighbors, Please help, hivemind. Outlook Setting has plaintext Greyed out! So this is where the setting is located but a user on my network has their outlook setting messaging format locked (greyed out) on plaintext. Any ideas are appreciated. If I create a new message, click the body of the message and click insert, the option to insert a poll is missing. There no strict policy assigned to the user. 20148 Click to Run) from the Microsoft 365 Apps for enterprise subscription product on a Windows 10 machine. I've spent hours googling fixes and have tried everything. While many users appreciate its array of features, they can also encounter certain frustrating issues. If I customize the toolbar and add a group and explicitly add the command there, it's always grayed out. I'm using the Outlook desktop client version 2208 (Build 15601. However, this option is greyed out and defaults to "Plain text". Opening in a browser will print more data, but it still cuts off data to the right-hand side if there are many May 23, 2025 · Understanding the "Save As" Button Being Greyed Out in Outlook Microsoft Outlook is a powerful email client that is widely used for personal, professional, and organizational communication. Sep 26, 2024 · Outlook will not allow me to format text, even after switching to HTML options are still greyed out - please help Aug 3, 2024 · If the Paste Special option is missing or not working in Office apps like Word, Excel, etc. Select HTML or Rich Text from the format options. Can anyone help? Mar 6, 2025 · I've spent hours on this. Why Is My Basic Text Greyed Out In Outlook? Have you ever faced issues with greyed-out text formatting options in Outlook? In this informative video, we will guide you through the reasons behind Mar 7, 2025 · Can’t format email text in Outlook: Here’s what you can do When you reply to an email, Outlook automatically adopts the original format. Working 100%. 20200 64Bit. ’ then Select ‘Mail’ from the list on the left. Changing font and the full box (sender, subject and even the background for instance) is not yet supported in the New Outlook. Here are some steps you can take to troubleshoot the issue: Check if the email is in Plain Text format: If the email is set to Plain Text, the editor features, including spell check, may not be available. I checked my Outlook 2010 and same issue. It will allow the formatting tools to be used. For example, you can control how you copy and paste content into an email message, whether Outlook uses AutoComplete as you type, table formatting, and field shading. are grayed out when composing a new email despite the fact that html is selected as the format. They're not all greyed out but several are including: Read Aloud, Send to OneNote, Share to Teams, Report Phish, Send Documents, and… Sep 21, 2016 · Why would the Basic Text section of the Ribbon be grayed out so that text changes (such as Bold, Italic, Color etc. Misspelled words are underlined in red, but the spelling suggestions won't come up when the user clicks on the misspelled word or spell check doesn't work at all. Microsoft support has been giving me the runaround for an hour. How can I enable the text type? ed Trying to reply to an email but cannot forma the text? Is the bold or italic or font colour option greyed out? Learn why it happens and how to remedy! 3 days ago · Additionally, ensure that you are using the correct email format (HTML or Plain Text) as this can also affect the appearance of your emails. This is under all categories at top (Message / Insert / Options / etc. After I send the note, Outlook mail reverts to the greyed out 11. 07 Steps to reproduce Insert an image inline Click on the image (select it) The contextual 'Image" tabe should appear in the ribbon (add 3d effects and so on) Sep 4, 2021 · I use outlook email on the web browser, and up till a month ago, everything was working fine. 16327. Now for some reason when I try a note via Outlook, my font shows a greyed out 11, and the message comes out very tiny. Change the format of all new messages in classic Outlook On the File tab, choose Options > Mail. Sep 26, 2024 · Outlook will not allow me to format text, even after switching to HTML options are still greyed out - please help Feb 18, 2022 · This post discusses why formatting options are sometimes not available in an email in Outlook and how you can regain access to formatting options. Mar 24, 2017 · When I go to File, Options, Stationery and Fonts in Outlook, the buttons to change fonts are greyed out. You can change the format to HTML or Rich Text by going to the Format Text tab in the Mar 29, 2023 · As per your mentioned description about "I want to format an email but my formatting options are greyed out". Some email clients only allow you to make basic formatting changes, but Outlook lets you change colors, add images and create paragraphs just like you can make in a word processing document. Mar 29, 2025 · If Mark Partition as Active, Change Drive Letter, Format, Extend, Shrink, Delete Volume options are greyed out in Disk Management, see this post. In Home & Business (2016, 2019, 2021) the Outlook>File>Print options have the necessary scaling & page orientation features to quickly modify & print from within Outlook. This is maddening - I have to open each email and then the… Are you facing issues with greyed-out buttons in Outlook? This video will guide you through the common reasons why certain features may become unresponsive and provide you with practical solutions Jan 7, 2025 · This is so in both Outlook desktop and web apps. The new version only has the…. Jun 30, 2025 · With Plain text, no formatting is allowed (no bold, font size changes or colors) and the formatting toolbar is greyed out. I'm on my work laptop which is a new windows 11 pc and it doesn't allow me to use the old outlook. This just suddenly happened today and I dont know what is going on. Both were working fine before the last update 28/03/23 and formatting to HTML Now, despite checking all settings in Trust Centre & Options, neither PC can be made to format emails… Nov 29, 2012 · I find that frequently when I go to reply to an email the Bold and Underline formatting options are grayed out and unuseable. We do a great amount of business correspondence by email and this is a serious irritant for us. What is going on here? When using Outlook 2019 on my Desktop PC I can use the translate feature without issues. Apr 24, 2020 · I am trying to complete my homework and I am going off my textbook instructions and it specifically asks ""With cell A1 selected, click the Insert tab, click Feb 27, 2024 · If Microsoft Outlook is not printing any emails or attachments on your Windows 10 or 11 PC, try these tips to fix the issue. To change the format: Open the email you are composing. Under Compose messages, in the Compose messages in this format list, select HTML, Plain Text, or Rich Text, then OK. I have an active outlook account. " My thoughts are go into programs and features and repair MS office. If you want to add formatting to your message, you will need to send the message in HTML format. To change the formatting: Sep 5, 2024 · Facing greyed-out options in Outlook? Discover common issues like Send/Receive, add-ins, and automatic replies, plus easy solutions to fix them. It is worth noting that some formatting options may be greyed out in Outlook. However, a common frustration among users, whether working in Microsoft Office, Google Slides, or other multimedia editing tools, is encountering grayed-out picture format options. Feb 10, 2024 · Font problems In the past when I send a message on Outlook mail, the font was always 11. Advice/help would be appreciated. When I email a co-worker or someone with the same domain address as me, I don't have anything greyed out, and I can access all… Struggling with bold and font size options greyed out in Outlook? Discover expert solutions and tips to resolve your email formatting issues on our Q&A page! Sep 26, 2024 · Outlook will not allow me to format text, even after switching to HTML options are still greyed out - please help In the message window, choose Format Text, and then choose HTML, Plain Text, or Rich Text. Dec 2, 2021 · Hello, I'm working with a user who has several buttons on the Outlook toolbar that are greyed out and don't work. It is an HTML email. i have been trying to figure out how to change the font color in a reply. I tried the Ctrl+k keyboard shortcut, but it doesn't work either. My setting was already set to HTML. But the format box is greyed out and I can't find anything to change that. Paste Special allows you to paste using the formatting of your choice. Jun 5, 2024 · Apart from that, it gives you more editing options than the built-in OWA or Outlook email signature editor. I have more than one PC and this is the only PC where the icons are Oct 4, 2023 · If your Outlook zoom has greyed out, then do not panic. I try to go File>option>Edit Option> Prooffing > Autocorrect option but eveyting was grayed out cannot do any changes, Finally I found the below solution which fixed my issue, if you have any other smart way please share it : Solution: Your Office Jun 26, 2015 · A user noticed Writing Style settings is grayed out. What steps can i take to fix this issue? Nov 23, 2023 · Troubleshoot the import/export option greyed out in Outlook with expert solutions. Go to the Format Text tab. Did I accidently click on something to inactivate? Oct 19, 2023 · I saved templates in . Why are these features… Just like formatting a document, formatting an email requires effective font and paragraph formatting. This is often because the message format is set to Plain Text, which does not support advanced formatting options. How can I enable this option is order to store AutoCorrect entries with formatting? Aug 6, 2024 · The legacy outlook will not allow me to format events (see image - the formatting options are greyed out). i went to options Mar 30, 2023 · We have Outlook on 2 PCs, one running Windows 10, the other is on 11. This looks like a glitch in Outlook, to confirm this, please go to Outlook web and see if it works without problem, also, can you format texts on other Apple devices such iPhone and iPad? Please perform the following steps to try to fix the app. Aug 28, 2018 · The text formatting features and many others are greyed out on my MS Outlook version (15. The fields are grayed out. Resolve issues quickly for seamless email management. In the new outlook when adding in my contacts via csv, there is not an option for Map Custom Fields. this creates two problems, first you cant change the font size, color, etc on the ribbon and second when replying the font is still black/automatic. Oct 19, 2023 · I saved templates in . You can change it permanently for all replies/forward by: Go to File > Options > Mail > Under Compose messages, choose Compose messages in this format to HTML and toggle Ignore original message test in reply and forward. Any Help? Jun 5, 2024 · Apart from that, it gives you more editing options than the built-in OWA or Outlook email signature editor. Microsoft 365 email signature grayed out This issue might occur if you access your Microsoft 365 email account in Outlook. On my Laptop also using Outlook 2019 with the newest updates it just shows the translate feature as grayed out and when using "translate" it just says "no services available" also under options -> language there is no translate option to be found. When I want to have a picture embedded inside a new email message. Merge to Email Option is Greyed out when trying to get email to merge from Word to Outlook? I attempted it on my comupter and it works totally fine but my collegues computers has the button greyed out. Fix Outlook Toolbar is missing If the Outlook Toolbar is missing, you can show it by tweaking format options in the Outlook email composer. Just like formatting a document, formatting an email requires effective font and paragraph formatting. Jun 23, 2009 · The 400 people where I work cannot set Outlook 2003 Mail Format options. After establishing my cursor in the body of the new email message and selecting INSERT, the picture icon in the illustrations box is grayed out. Just hop on this article to find out the most effective solutions to fix here. exe are in the office14 folder. exe and Winword. If you take this option and then receive an email in plain text, your font settings will be disabled. Apr 9, 2018 · My Issue: I was having a spell check issue in outlook 2016, I installed proofing it fixed world and rest of the MS office apps but not outlook 2016. Feb 23, 2009 · But when you get to writing the body of the email, you notice that the text formatting buttons are mostly greyed out (eg bold, underline, italics, cut, copy, paste, font size, font color, paragraph justification, bullets and numbering, indenting). Repair Your Microsoft Office 365 Nov 2, 2023 · For 365 for Business, it appears that the Outlook>File>Print options have been engineered out of the application. We are using Microsoft Office Home and Business. Feb 27, 2024 · Users report issues with bullet points not displaying correctly in Outlook and Exchange emails. bjwzulmakymffiyyndhnppdrvcipcciwpqaihkzoccqizcaagwrtbyrehjfjlehphnznlbazybpkb